Stanniocalcin 1/STC-1 Antibody (1A3)

Images

 
Immunocytochemistry/ Immunofluorescence: Stanniocalcin 1/STC-1 Antibody (1A3) [H00006781-M02] - Analysis of monoclonal antibody to STC1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Stanniocalcin 1/STC-1 Antibody (1A3) [H00006781-M02] - Detection limit for recombinant GST tagged STC1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Stanniocalcin 1/STC-1 Antibody (1A3) Summary

Immunogen
STC1 (AAH29044 141 a.a. - 247 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Stanniocalcin 1/STC-1 Antibody (1A3)

  • Stanniocalcin 1
  • stanniocalcin-1
  • STC1
  • STC-1
  • STCSTC-1

Background

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2830
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-35213
Species: Hu
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
2629-FG/CF
Species: Mu
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for Stanniocalcin 1/STC-1 Antibody (H00006781-M02) (0)

There are no publications for Stanniocalcin 1/STC-1 Antibody (H00006781-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M02) (0)

There are no reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Stanniocalcin 1/STC-1 Antibody (H00006781-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Stanniocalcin 1/STC-1 Products

Bioinformatics Tool for Stanniocalcin 1/STC-1 Antibody (H00006781-M02)

Discover related pathways, diseases and genes to Stanniocalcin 1/STC-1 Antibody (H00006781-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stanniocalcin 1/STC-1 Antibody (H00006781-M02)

Discover more about diseases related to Stanniocalcin 1/STC-1 Antibody (H00006781-M02).
 

Pathways for Stanniocalcin 1/STC-1 Antibody (H00006781-M02)

View related products by pathway.

PTMs for Stanniocalcin 1/STC-1 Antibody (H00006781-M02)

Learn more about PTMs related to Stanniocalcin 1/STC-1 Antibody (H00006781-M02).
 

Research Areas for Stanniocalcin 1/STC-1 Antibody (H00006781-M02)

Find related products by research area.

Blogs on Stanniocalcin 1/STC-1

There are no specific blogs for Stanniocalcin 1/STC-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stanniocalcin 1/STC-1 Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol STC1
Entrez
Uniprot