Recombinant Human Stabilin-1 Protein

Images

 
SDS-Page: Recombinant Human Stabilin-1 Protein [H00023166-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Stabilin-1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1804-1902 of Human Stabilin-1

Source: Wheat Germ

Amino Acid Sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
STAB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Stabilin-1 Protein

  • CLEVER-1
  • fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-1
  • Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 1
  • FEEL1
  • FEEL-1
  • FEEL-1MS-1 antigen
  • FELE-1
  • FEX1
  • KIAA0246common lymphatic endothelial and vascular endothelial receptor-1
  • MS-1 Antigen
  • STAB1
  • STAB-1
  • stabilin 1
  • Stabilin1
  • Stabilin-1

Background

STAB1 - stabilin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3645
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-81901
Species: Hu
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92417
Species: Hu
Applications: ICC/IF
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NBP1-89671
Species: Hu
Applications: WB, IHC, IHC-P
AF2125
Species: Mu
Applications: WB, IHC
796-IC
Species: Mu

Publications for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no publications for Stabilin-1 Partial Recombinant Protein (H00023166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no reviews for Stabilin-1 Partial Recombinant Protein (H00023166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Discover related pathways, diseases and genes to Stabilin-1 Partial Recombinant Protein (H00023166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Discover more about diseases related to Stabilin-1 Partial Recombinant Protein (H00023166-Q01).
 

Pathways for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

View related products by pathway.

PTMs for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Learn more about PTMs related to Stabilin-1 Partial Recombinant Protein (H00023166-Q01).

Blogs on Stabilin-1

There are no specific blogs for Stabilin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Stabilin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STAB1