Recombinant Human Stabilin-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Stabilin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1804-1902 of Human STAB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STAB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Stabilin-1 Protein

  • CLEVER-1
  • fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-1
  • Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 1
  • FEEL1
  • FEEL-1
  • FEEL-1MS-1 antigen
  • FELE-1
  • FEX1
  • KIAA0246common lymphatic endothelial and vascular endothelial receptor-1
  • MS-1 Antigen
  • STAB1
  • STAB-1
  • stabilin 1
  • Stabilin1
  • Stabilin-1

Background

STAB1 - stabilin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3645
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-81901
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009784-T01
Species: Hu
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB100-57090
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF2125
Species: Mu
Applications: WB, IHC
796-IC
Species: Mu

Publications for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no publications for Stabilin-1 Partial Recombinant Protein (H00023166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no reviews for Stabilin-1 Partial Recombinant Protein (H00023166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Stabilin-1 Partial Recombinant Protein (H00023166-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Stabilin-1 Products

Bioinformatics Tool for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Discover related pathways, diseases and genes to Stabilin-1 Partial Recombinant Protein (H00023166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Discover more about diseases related to Stabilin-1 Partial Recombinant Protein (H00023166-Q01).
 

Pathways for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

View related products by pathway.

PTMs for Stabilin-1 Partial Recombinant Protein (H00023166-Q01)

Learn more about PTMs related to Stabilin-1 Partial Recombinant Protein (H00023166-Q01).

Blogs on Stabilin-1

There are no specific blogs for Stabilin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Stabilin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STAB1
Entrez