ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

Images

 
Western Blot: ST8SIA4 Antibody [NBP1-79292] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human ST8SIA4The immunogen for this antibody is ST8SIA4. Peptide sequence DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST8SIA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ST8SIA4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

  • Alpha-2,8-sialyltransferase 8D
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
  • EC 2.4.99
  • EC 2.4.99.-
  • polysialyltransferase-1
  • PST1
  • PST1MGC61459
  • PSTMGC34450
  • sialyltransferase 8 (alpha-2, 8-polysialytransferase) D
  • Sialyltransferase 8D
  • Sialytransferase St8Sia IV
  • SIAT8D
  • SIAT8-D
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • ST8SIA4
  • ST8SIAIV
  • ST8SIA-IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-207
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-79292
Species: Hu
Applications: WB

Publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292)

Discover related pathways, diseases and genes to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292)

Discover more about diseases related to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292).
 

Pathways for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292)

View related products by pathway.

PTMs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292)

Learn more about PTMs related to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292).
 

Research Areas for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP1-79292)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST8SIA4
Entrez
Uniprot