ST6GALNAC4 Antibody

Images

 
Western Blot: ST6GALNAC4 Antibody [NBP1-62417] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6GALNAC4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ST6GALNAC4(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 4) The peptide sequence was selected from the middle region of ST6GALNAC4. Peptide sequence QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST6GALNAC4 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6GALNAC4 Antibody

  • EC 2.4.99
  • EC 2.4.99.7
  • NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase IV
  • NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase
  • Sialyltransferase 3C
  • Sialyltransferase 7D
  • sialyltransferase 7D((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase)
  • SIAT3C
  • SIAT3-C
  • SIAT3C6-sialyltransferasealpha2,6-sialyltransferase
  • SIAT7D
  • SIAT7-D
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 4
  • ST6GalNAc IV
  • ST6GALNAC4
  • ST6GalNAcIV

Background

ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31603
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
MAB6715
Species: Hu
Applications: WB
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-82605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80751
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62417
Species: Hu
Applications: WB

Publications for ST6GALNAC4 Antibody (NBP1-62417) (0)

There are no publications for ST6GALNAC4 Antibody (NBP1-62417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6GALNAC4 Antibody (NBP1-62417) (0)

There are no reviews for ST6GALNAC4 Antibody (NBP1-62417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6GALNAC4 Antibody (NBP1-62417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6GALNAC4 Products

Bioinformatics Tool for ST6GALNAC4 Antibody (NBP1-62417)

Discover related pathways, diseases and genes to ST6GALNAC4 Antibody (NBP1-62417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6GALNAC4 Antibody (NBP1-62417)

Discover more about diseases related to ST6GALNAC4 Antibody (NBP1-62417).
 

Pathways for ST6GALNAC4 Antibody (NBP1-62417)

View related products by pathway.

Blogs on ST6GALNAC4

There are no specific blogs for ST6GALNAC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6GALNAC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC4
Entrez
Uniprot