ST6GALNAC3 Antibody

Images

 
Western Blot: ST6GALNAC3 Antibody [NBP2-31603] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30
Immunocytochemistry/ Immunofluorescence: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6GALNAC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ST6GALNAC3 Protein (NBP2-31603PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6GALNAC3 Antibody

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III
  • EC 2.4.99.-
  • EC 2.4.99.7
  • FLJ13669
  • FLJ27239
  • GalNAc alpha-2,6-sialyltransferase III
  • PRO7177
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C
  • Sialyltransferase 7C
  • SIAT7C
  • SIAT7-C
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3
  • ST6GalNAc III
  • ST6GALNACIII
  • STY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
6876-GT
Species: Hu
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB6715
Species: Hu
Applications: WB
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P

Publications for ST6GALNAC3 Antibody (NBP2-31603) (0)

There are no publications for ST6GALNAC3 Antibody (NBP2-31603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6GALNAC3 Antibody (NBP2-31603) (0)

There are no reviews for ST6GALNAC3 Antibody (NBP2-31603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ST6GALNAC3 Antibody (NBP2-31603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6GALNAC3 Products

Bioinformatics Tool for ST6GALNAC3 Antibody (NBP2-31603)

Discover related pathways, diseases and genes to ST6GALNAC3 Antibody (NBP2-31603). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6GALNAC3 Antibody (NBP2-31603)

Discover more about diseases related to ST6GALNAC3 Antibody (NBP2-31603).
 

Pathways for ST6GALNAC3 Antibody (NBP2-31603)

View related products by pathway.

Blogs on ST6GALNAC3

There are no specific blogs for ST6GALNAC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6GALNAC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC3
Uniprot