ST6 Sialyltransferase 6/ST6GALNAC6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ST6 Sialyltransferase 6/ST6GALNAC6 Antibody [NBP1-80751] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ST6 Sialyltransferase 6/ST6GALNAC6 Antibody [NBP1-80751] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6 Sialyltransferase 6/ST6GALNAC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWF
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ST6 Sialyltransferase 6/ST6GALNAC6 Protein (NBP1-80751PEP)
Publications
Read Publications using
NBP1-80751 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6 Sialyltransferase 6/ST6GALNAC6 Antibody

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  • CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI
  • EC 2.4.99
  • EC 2.4.99.-
  • EC 2.4.99.7
  • GalNAc alpha-2,6-sialyltransferase VI
  • hST6GalNAc VI
  • RP11-203J24.3
  • Sialyltransferase 7F
  • sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F
  • SIAT7F
  • SIAT7-F
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6
  • ST6GalNAc VI
  • ST6GALNAC6
  • ST6GALNACVI

Background

Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)), a representative tumor-associated antigen in cancers of the pancreas and colon, in colon tissues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31603
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6715
Species: Hu
Applications: WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-20491
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20494
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5924
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
6876-GT
Species: Hu
Applications: EnzAct
NBP1-80751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for ST6 Sialyltransferase 6/ST6GALNAC6 Antibody (NBP1-80751)(2)

Reviews for ST6 Sialyltransferase 6/ST6GALNAC6 Antibody (NBP1-80751) (0)

There are no reviews for ST6 Sialyltransferase 6/ST6GALNAC6 Antibody (NBP1-80751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ST6 Sialyltransferase 6/ST6GALNAC6 Antibody (NBP1-80751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6 Sialyltransferase 6/ST6GALNAC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC6
Entrez
Uniprot