ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody


Western Blot: ST6GALNAC5 Antibody [NBP1-69618] - This Anti-ST6GALNAC5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody Summary

Synthetic peptides corresponding to ST6GALNAC5(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 5) The peptide sequence was selected from the middle region of ST6GALNAC5. Peptide sequence AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALE
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST6GALNAC5 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody

  • alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase E
  • EC 2.4.99
  • EC 2.4.99.-
  • EC
  • GalNAc alpha-2,6-sialyltransferase V
  • GD1 alpha synthase
  • MGC3184
  • sialyltransferase 7 (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase) E
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) E
  • Sialyltransferase 7E
  • SIAT7E
  • SIAT7-E
  • SIAT7Ealpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase V
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5
  • ST6 neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5
  • ST6GalNAc V
  • ST6GalNAcV
  • ST6GalNAcValpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5


ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB

Publications for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618) (0)

There are no publications for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618) (0)

There are no reviews for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Products

Bioinformatics Tool for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618)

Discover related pathways, diseases and genes to ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618)

Discover more about diseases related to ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618).

Pathways for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618)

View related products by pathway.

PTMs for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618)

Learn more about PTMs related to ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (NBP1-69618).

Blogs on ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5

There are no specific blogs for ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody and receive a gift card or discount.


Gene Symbol ST6GALNAC5