ST3GAL6 Antibody

Images

 
Western Blot: ST3GAL6 Antibody [NBP2-85827] - Host: Rabbit. Target Name: ST3GAL6. Sample Tissue: Human Lung Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST3GAL6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST3GAL6. Peptide sequence: SYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ST3GAL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST3GAL6 Antibody

  • alpha2,3-sialyltransferase
  • CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI
  • EC 2.4.99
  • EC 2.4.99.-
  • EC 2.4.99.9
  • Sialyltransferase 10
  • SIAT10
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  • ST3Gal VI
  • ST3GAL6
  • ST3GALVI
  • ST3GALVIsialyltransferase 10 (alpha-2,3-sialyltransferase VI)
  • type 2 lactosamine alpha-2,3-sialyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5924
Species: Hu
Applications: IHC, Simple Western, WB
AF5357
Species: Hu
Applications: IP, Neut, WB
7268-CT
Species: Hu
Applications: BA
NBP2-57960
Species: Hu
Applications: ICC/IF
MEP00B
Species: Mu
Applications: ELISA
AF1049
Species: Hu
Applications: IHC, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
D6050
Species: Hu
Applications: ELISA
7887-GT
Species: Mu
Applications: EnzAct
NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-88654
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-95141
Species: Mu, Rt
Applications: IHC-P, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-85827
Species: Hu
Applications: WB

Publications for ST3GAL6 Antibody (NBP2-85827) (0)

There are no publications for ST3GAL6 Antibody (NBP2-85827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3GAL6 Antibody (NBP2-85827) (0)

There are no reviews for ST3GAL6 Antibody (NBP2-85827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3GAL6 Antibody (NBP2-85827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3GAL6 Products

Bioinformatics Tool for ST3GAL6 Antibody (NBP2-85827)

Discover related pathways, diseases and genes to ST3GAL6 Antibody (NBP2-85827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL6 Antibody (NBP2-85827)

Discover more about diseases related to ST3GAL6 Antibody (NBP2-85827).
 

Pathways for ST3GAL6 Antibody (NBP2-85827)

View related products by pathway.

PTMs for ST3GAL6 Antibody (NBP2-85827)

Learn more about PTMs related to ST3GAL6 Antibody (NBP2-85827).
 

Research Areas for ST3GAL6 Antibody (NBP2-85827)

Find related products by research area.

Blogs on ST3GAL6

There are no specific blogs for ST3GAL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3GAL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL6