ST3GAL5 Antibody - BSA Free

Western Blot: ST3GAL5 Antibody [NBP2-32612] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry: ST3GAL5 Antibody [NBP2-32612] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ST3GAL5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ST3GAL5 Antibody - BSA Free (NBP2-32612) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ST3GAL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ST3GAL5 Protein (NBP2-32612PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ST3GAL5 Antibody - BSA Free

• 3S-T
• alpha 2,3-sialyltransferase V
• CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase
• EC 2.4.99.9
• Ganglioside GM3 Synthase
• GM3 synthase
• lactosylceramide alpha-2,3-sialyltransferase
• SATI
• sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase)
• Sialyltransferase 9
• Siat9
• SIATGM3S
• ST3 beta-galactoside alpha-2,3-sialyltransferase 5
• ST3Gal V
• ST3GAL5
• ST3GALV
• ST3GalVSIAT9SATI

Background

ST3GAL5 - ST3 beta-galactoside alpha-2,3-sialyltransferase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST3GAL5