SSR3 Antibody

Images

 
Western Blot: SSR3 Antibody [NBP2-83597] - Host: Rabbit. Target Name: SSR3. Sample Tissue: Human PC-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSR3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SSR3. Peptide sequence: EADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SSR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSR3 Antibody

  • signal sequence receptor, gamma (translocon-associated protein gamma)
  • SSR gamma
  • SSR-gamma
  • translocon-associated protein gamma subunit
  • translocon-associated protein subunit gamma
  • TRAP-complex gamma subunit
  • TRAP-gamma
  • TRAPGSignal sequence receptor subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7754-BH/CF
Species: Hu
Applications: BA
NBP1-69471
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
MAB197
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
202-IL
Species: Hu
Applications: BA
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
126-FL/CF
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
DCDL40
Species: Hu
Applications: ELISA
NBP1-92190
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-89631
Species: Hu, Mu, Po, RM
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-20940
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB6549
Species: Hu
Applications: WB
NBP2-83597
Species: Hu
Applications: WB

Publications for SSR3 Antibody (NBP2-83597) (0)

There are no publications for SSR3 Antibody (NBP2-83597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSR3 Antibody (NBP2-83597) (0)

There are no reviews for SSR3 Antibody (NBP2-83597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSR3 Antibody (NBP2-83597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSR3 Products

Bioinformatics Tool for SSR3 Antibody (NBP2-83597)

Discover related pathways, diseases and genes to SSR3 Antibody (NBP2-83597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSR3 Antibody (NBP2-83597)

Discover more about diseases related to SSR3 Antibody (NBP2-83597).
 

Pathways for SSR3 Antibody (NBP2-83597)

View related products by pathway.

Research Areas for SSR3 Antibody (NBP2-83597)

Find related products by research area.

Blogs on SSR3

There are no specific blogs for SSR3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR3