SSR3 Antibody - BSA Free

Western Blot: SSR3 Antibody [NBP2-83597] - Host: Rabbit. Target Name: SSR3. Sample Tissue: Human PC-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SSR3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSR3. Peptide sequence: EADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SSR3 Antibody - BSA Free

• signal sequence receptor, gamma (translocon-associated protein gamma)
• SSR gamma
• SSR-gamma
• translocon-associated protein gamma subunit
• translocon-associated protein subunit gamma
• TRAP-complex gamma subunit
• TRAP-gamma
• TRAPGSignal sequence receptor subunit gamma

Background

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. The protein encoded by this gene is the gamma subunit and is predicted to span the membrane four times. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSR3