SRp55 Antibody (5G6)


Western Blot: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of SFRS6 expression in transfected 293T cell line by SFRS6 monoclonal antibody (M02), clone 5G6.Lane 1: SFRS6 transfected lysate(39.6 KDa).Lane 2: more
Immunocytochemistry/ Immunofluorescence: SRp55 Antibody (5G6) [H00006431-M02] - Analysis of monoclonal antibody to SFRS6 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SRp55 Antibody (5G6) [H00006431-M02] - Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

SRp55 Antibody (5G6) Summary

SFRS6 (NP_006266, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR
SFRS6 - splicing factor, arginine/serine-rich 6 (5G6)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRp55 Antibody (5G6)

  • B52
  • FLJ08061
  • pre-mRNA splicing factor SRP55
  • Pre-mRNA-splicing factor SRP55
  • serine/arginine-rich splicing factor 6
  • SFRS6
  • Splicing factor, arginine/serine-rich 6MGC5045
  • splicing factor, arginine/serine-rich, 55 kDa
  • SR splicing factor 6
  • SRP55arginine/serine-rich splicing factor 6


The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SRp55 Antibody (H00006431-M02) (0)

There are no publications for SRp55 Antibody (H00006431-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRp55 Antibody (H00006431-M02) (0)

There are no reviews for SRp55 Antibody (H00006431-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SRp55 Antibody (H00006431-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SRp55 Products

Bioinformatics Tool for SRp55 Antibody (H00006431-M02)

Discover related pathways, diseases and genes to SRp55 Antibody (H00006431-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRp55 Antibody (H00006431-M02)

Discover more about diseases related to SRp55 Antibody (H00006431-M02).

Pathways for SRp55 Antibody (H00006431-M02)

View related products by pathway.

PTMs for SRp55 Antibody (H00006431-M02)

Learn more about PTMs related to SRp55 Antibody (H00006431-M02).

Blogs on SRp55

There are no specific blogs for SRp55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SRp55 Antibody (5G6) and receive a gift card or discount.


Gene Symbol SRSF6