Recombinant Human SRD5A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SRD5A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28-65 of Human SRD5A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA

Protein/Peptide Type
Partial Recombinant Protein
Gene
SRD5A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, pH 7.5, 10% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRD5A2 Protein

  • 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2
  • EC 1.3.99.5
  • MGC138457
  • S5AR 2
  • SR type 2
  • Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2
  • steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2)
  • Type II 5-alpha reductase

Background

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). SRD5A2(, 28 a.a. - 65 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-1491
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SRD5A2 Partial Recombinant Protein (H00006716-Q01) (0)

There are no publications for SRD5A2 Partial Recombinant Protein (H00006716-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRD5A2 Partial Recombinant Protein (H00006716-Q01) (0)

There are no reviews for SRD5A2 Partial Recombinant Protein (H00006716-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRD5A2 Partial Recombinant Protein (H00006716-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRD5A2 Products

Bioinformatics Tool for SRD5A2 Partial Recombinant Protein (H00006716-Q01)

Discover related pathways, diseases and genes to SRD5A2 Partial Recombinant Protein (H00006716-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRD5A2 Partial Recombinant Protein (H00006716-Q01)

Discover more about diseases related to SRD5A2 Partial Recombinant Protein (H00006716-Q01).
 

Pathways for SRD5A2 Partial Recombinant Protein (H00006716-Q01)

View related products by pathway.

PTMs for SRD5A2 Partial Recombinant Protein (H00006716-Q01)

Learn more about PTMs related to SRD5A2 Partial Recombinant Protein (H00006716-Q01).
 

Research Areas for SRD5A2 Partial Recombinant Protein (H00006716-Q01)

Find related products by research area.

Blogs on SRD5A2

There are no specific blogs for SRD5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SRD5A2 Antibody
NBP1-46510

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRD5A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRD5A2