SRD5A1 Antibody

Images

 
Western Blot: SRD5A1 Antibody [H00006715-D01P] - Analysis of SRD5A1 expression in transfected 293T cell line by SRD5A1 polyclonal antibody.Lane 1: SRD5A1 transfected lysate(29.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, MiAr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRD5A1 Antibody Summary

Immunogen
SRD5A1 (NP_001038.1, 1 a.a. - 259 a.a.) full-length human protein. MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Specificity
Reacts with steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRD5A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Microarray
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. Use in microarray reported in scientific literature (PMID: 28955722).
Control
SRD5A1 Knockout HeLa Cell Lysate
Publications
Read Publications using
H00006715-D01P in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28955722). Rat reactivity reported in scientific literature (DOI:10.4172/2155-6156.1000239).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRD5A1 Antibody

  • 3-oxo-5-alpha-steroid 4-dehydrogenase 1
  • EC 1.3.99.5,3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
  • S5AR 1
  • SR type 1
  • Steroid 5-alpha-reductase 1,5-alpha reductase
  • steroid 5-alpha-reductase type I
  • steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 1)

Background

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, Gp, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32353
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
MAB6529
Species: Hu
Applications: WB, Simple Western
NB110-78644
Species: Hu, Rt, Po, Pm, Bv, Gt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85368
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SRD5A1 Antibody (H00006715-D01P)(5)

Reviews for SRD5A1 Antibody (H00006715-D01P) (0)

There are no reviews for SRD5A1 Antibody (H00006715-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRD5A1 Antibody (H00006715-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SRD5A1 Products

Bioinformatics Tool for SRD5A1 Antibody (H00006715-D01P)

Discover related pathways, diseases and genes to SRD5A1 Antibody (H00006715-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRD5A1 Antibody (H00006715-D01P)

Discover more about diseases related to SRD5A1 Antibody (H00006715-D01P).
 

Pathways for SRD5A1 Antibody (H00006715-D01P)

View related products by pathway.

PTMs for SRD5A1 Antibody (H00006715-D01P)

Learn more about PTMs related to SRD5A1 Antibody (H00006715-D01P).

Blogs on SRD5A1

There are no specific blogs for SRD5A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRD5A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRD5A1
Entrez
Uniprot
COVID-19 update