SRD5A1 Antibody

Western Blot: SRD5A1 Antibody [H00006715-D01P] - Analysis of SRD5A1 expression in transfected 293T cell line by SRD5A1 polyclonal antibody.Lane 1: SRD5A1 transfected lysate(29.50 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

SRD5A1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SRD5A1 (NP_001038.1, 1 a.a. - 259 a.a.) full-length human protein. MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
• Specificity: Reacts with steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRD5A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Microarray
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. Use in microarray reported in scientific literature (PMID: 28955722).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28955722). Rat reactivity reported in scientific literature (DOI:10.4172/2155-6156.1000239).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRD5A1 Antibody

• 3-oxo-5-alpha-steroid 4-dehydrogenase 1
• EC 1.3.1.22
• EC 1.3.99.5,3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
• S5AR 1
• SR type 1
• SRD5A1
• Steroid 5-alpha-reductase 1,5-alpha reductase
• steroid 5-alpha-reductase type I
• steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 1)

Background

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SRD5A1 Antibody (H00006715-D01P)(5)

Publications using H00006715-D01P

• Acharya KD, Nettles SA, Sellers KJ et al. The Progestin Receptor Interactome in the Female Mouse Hypothalamus: Interactions with Synaptic Proteins Are Isoform Specific and Ligand Dependent. eNeuro 2017-09-20 [PMID: 28955722] (MiAr, Mouse)
• Horii N, Sato K, Mesaki N, Iemitsu M. Increased Muscular 5alpha-Dihydrotestosterone in Response to Resistance Training Relates to Skeletal Muscle Mass and Glucose Metabolism in Type 2 Diabetic Rats. PLoS One 2016-11-10 [PMID: 27832095]
• Chang KH, Li R, Papari-Zareei M et al. Dihydrotestosterone synthesis bypasses testosterone to drive castration-resistant prostate cancer. Proc Natl Acad Sci U S A. 2011-07-27 [PMID: 21795608]
• Park JH, Aizawa K, Iemitsu M et al. DHEA Administration Activates Local Bioactive Androgen Metabolism in Cancellous Site of Tibia of Ovariectomized Rats. Calcif Tissue Int 2011-06-08 [PMID: 21656023]
• Sato K, Fujita S, Yamauchi H et al. The Exercise-Induced Improvement in hyperglycemia is Mediated by DHT Produced in the Skeletal Muscle of Zucker Diabetic Fatty Rats. J Diabetes Complications 2012-12-26 (WB, Rat)

Bioinformatics

• Gene Symbol: SRD5A1
• Entrez:
  • 6715(Human)
• Uniprot:
  • NP_001038.1(Human)