Src Antibody - BSA Free

Western Blot: Src Antibody [NBP2-38165] - Analysis in human cell lines A-549 and HeLa using anti-SRC antibody. Corresponding SRC RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.

Immunocytochemistry/Immunofluorescence: Src Antibody [NBP2-38165] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Src Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Src Antibody - BSA Free (NBP2-38165) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
• Predicted Species: Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Src Protein (NBP2-38165PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Src Antibody - BSA Free

• ASV
• c-Src
• EC 2.7.10
• EC 2.7.10.2
• pp60c-src
• Rous sarcoma
• RSVgp4
• Src
• tyrosine kinase pp60c-src
• tyrosine-protein kinase SRC-1
• v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
• v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)

Background

Src is a protein tyrosine kinase known to regulate cellular adhesion. Composed of three major domains; SH2, SH3 and a kinase catalytic domain, Src can be switched from an inactive to an active state though control of its phosphorylation state or through protein-protein interaction. Phosphorylation of Y529 by Csk and Chk inactivates Src, while dephosphorylation of Y529 will modify its conformation to an open active state (1-3). Mutation of Y529 leads to Scr overactivity. Several cancers including colon and breast cancer have been associated with an increase of Src activity (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRC
• Uniprot:
  • P12931()