Src Antibody


Orthogonal Strategies: Western Blot: Src Antibody [NBP2-38165] - Analysis in human cell lines A-549 and HeLa using anti-SRC antibody. Corresponding SRC RNA-seq data are presented for the same cell lines. Loading more
Immunocytochemistry/ Immunofluorescence: Src Antibody [NBP2-38165] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Src Antibody [NBP2-38165] - Staining of human testis shows membranous and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Src Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
Specificity of human Src antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Src Lysate (NBP2-64959)
Src Lysate (NBP2-66171)
Control Peptide
Src Protein (NBP2-38165PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Src Antibody

  • ASV
  • c-Src
  • EC 2.7.10
  • EC
  • pp60c-src
  • Rous sarcoma
  • RSVgp4
  • Src
  • tyrosine kinase pp60c-src
  • tyrosine-protein kinase SRC-1
  • v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
  • v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Src Antibody (NBP2-38165) (0)

There are no publications for Src Antibody (NBP2-38165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Src Antibody (NBP2-38165) (0)

There are no reviews for Src Antibody (NBP2-38165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Src Antibody (NBP2-38165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Src Antibody (NBP2-38165)

Discover related pathways, diseases and genes to Src Antibody (NBP2-38165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Src Antibody (NBP2-38165)

Discover more about diseases related to Src Antibody (NBP2-38165).

Pathways for Src Antibody (NBP2-38165)

View related products by pathway.

PTMs for Src Antibody (NBP2-38165)

Learn more about PTMs related to Src Antibody (NBP2-38165).

Research Areas for Src Antibody (NBP2-38165)

Find related products by research area.

Blogs on Src.

Androgen Receptor: What Makes a Man?
Steroid receptors (SRs) are a superfamily of ligand-dependent nuclear transcription factors that activate responsive genes response to hormone. Androgen receptors (ARs) are found in a wide variety of tissues, including reproductive organs, central ner...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Src Antibody and receive a gift card or discount.


Gene Symbol SRC