SPTY2D1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPTY2D1 Antibody [NBP2-14502] - Staining of human cell line A-431 shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: SPTY2D1 Antibody [NBP2-14502] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPTY2D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHR RKKLETDGKLPPTVSKKAPSQKESVGTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTY2D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPTY2D1 Protein (NBP2-14502PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPTY2D1 Antibody

  • SPTY2D1 SPT2, Suppressor of Ty, domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7895
Species: Hu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF5087
Species: Hu
Applications: WB, Simple Western, IHC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92559
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-59687
Species: Hu
Applications: WB

Publications for SPTY2D1 Antibody (NBP2-14502) (0)

There are no publications for SPTY2D1 Antibody (NBP2-14502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTY2D1 Antibody (NBP2-14502) (0)

There are no reviews for SPTY2D1 Antibody (NBP2-14502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPTY2D1 Antibody (NBP2-14502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPTY2D1 Products

Bioinformatics Tool for SPTY2D1 Antibody (NBP2-14502)

Discover related pathways, diseases and genes to SPTY2D1 Antibody (NBP2-14502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPTY2D1

There are no specific blogs for SPTY2D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPTY2D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTY2D1