Recombinant Human SPTLC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPTLC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 43-143 of Human SPTLC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAATLASLKKYGVGTCGPRGFYGTFE

Protein/Peptide Type
Recombinant Protein
Gene
SPTLC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPTLC1 Protein

  • EC 2.3.1.50
  • hereditary sensory neuropathy, type 1
  • HSAN1
  • LBC1
  • LCB 1
  • LCB1HSAN
  • Long chain base biosynthesis protein 1
  • MGC14645
  • serine C-palmitoyltransferase
  • serine palmitoyltransferase 1
  • serine palmitoyltransferase, long chain base subunit 1
  • Serine-palmitoyl-CoA transferase 1
  • SPT 1
  • SPT1HSN1
  • SPTI

Background

SPTLC1( AAH07085, 43 a.a. - 144 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00010558-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPTLC1 Recombinant Protein (H00010558-P01) (0)

There are no publications for SPTLC1 Recombinant Protein (H00010558-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTLC1 Recombinant Protein (H00010558-P01) (0)

There are no reviews for SPTLC1 Recombinant Protein (H00010558-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPTLC1 Recombinant Protein (H00010558-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPTLC1 Products

Bioinformatics Tool for SPTLC1 Recombinant Protein (H00010558-P01)

Discover related pathways, diseases and genes to SPTLC1 Recombinant Protein (H00010558-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPTLC1 Recombinant Protein (H00010558-P01)

Discover more about diseases related to SPTLC1 Recombinant Protein (H00010558-P01).
 

Pathways for SPTLC1 Recombinant Protein (H00010558-P01)

View related products by pathway.

PTMs for SPTLC1 Recombinant Protein (H00010558-P01)

Learn more about PTMs related to SPTLC1 Recombinant Protein (H00010558-P01).

Blogs on SPTLC1

There are no specific blogs for SPTLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPTLC1 Antibody
NBP1-59643

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPTLC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTLC1