Splicing factor, arginine/serine-rich 11 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SRSF11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free
Background
The Splicing factor, arginine/serine-rich 11 gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Publications for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)
There are no publications for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)
There are no reviews for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Splicing factor, arginine/serine-rich 11 Products
Blogs on Splicing factor, arginine/serine-rich 11