SPINK9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPINK9 Antibody [NBP1-90990] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: SPINK9 Antibody [NBP1-90990] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPINK9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPINK9 Protein (NBP1-90990PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK9 Antibody

  • LEKTI2
  • lymphoepithelial Kazal-type-related inhibitor 2
  • serine peptidase inhibitor, Kazal type 9
  • serine protease inhibitor Kazal type 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2008
Species: Hu
Applications: WB, IHC, IP
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
MAB1719
Species: Hu
Applications: WB, IHC, ICC
2626-SE
Species: Hu
NBP2-13371
Species: Hu
Applications: IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54329
Species: Hu
Applications: WB
NBP1-90990
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SPINK9 Antibody (NBP1-90990) (0)

There are no publications for SPINK9 Antibody (NBP1-90990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK9 Antibody (NBP1-90990) (0)

There are no reviews for SPINK9 Antibody (NBP1-90990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPINK9 Antibody (NBP1-90990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK9 Products

SPINK9 NBP1-90990

Bioinformatics Tool for SPINK9 Antibody (NBP1-90990)

Discover related pathways, diseases and genes to SPINK9 Antibody (NBP1-90990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK9 Antibody (NBP1-90990)

Discover more about diseases related to SPINK9 Antibody (NBP1-90990).
 

Pathways for SPINK9 Antibody (NBP1-90990)

View related products by pathway.

Blogs on SPINK9

There are no specific blogs for SPINK9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK9