SPDEF Antibody

Images

 
Western Blot: SPDEF Antibody [NBP2-88355] - Host: Rabbit. Target Name: SPDEF. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SPDEF Antibody [NBP2-88355] - WB Suggested Anti-SPDEF Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Placenta
Western Blot: SPDEF Antibody [NBP2-88355] - Host: Rabbit. Target Name: SPDEF. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPDEF Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPDEF. Peptide sequence: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Canine (100%), Equine (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SPDEF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPDEF Antibody

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51541
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-88319
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87780
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF

Publications for SPDEF Antibody (NBP2-88355) (0)

There are no publications for SPDEF Antibody (NBP2-88355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDEF Antibody (NBP2-88355) (0)

There are no reviews for SPDEF Antibody (NBP2-88355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDEF Antibody (NBP2-88355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPDEF Products

Bioinformatics Tool for SPDEF Antibody (NBP2-88355)

Discover related pathways, diseases and genes to SPDEF Antibody (NBP2-88355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Antibody (NBP2-88355)

Discover more about diseases related to SPDEF Antibody (NBP2-88355).
 

Pathways for SPDEF Antibody (NBP2-88355)

View related products by pathway.

PTMs for SPDEF Antibody (NBP2-88355)

Learn more about PTMs related to SPDEF Antibody (NBP2-88355).

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDEF