Novus Biologicals products are now on bio-techne.com

SPC25 Recombinant Protein Antigen

Images

 
There are currently no images for SPC25 Protein (NBP2-47263PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SPC25 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPC25.

Source: E. coli

Amino Acid Sequence: RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPC25
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47263.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SPC25 Recombinant Protein Antigen

  • AD024
  • hSpc25
  • kinetochore protein Spc25
  • MGC22228,2600017H08Rik
  • SPBC25
  • SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • spindle pole body component 25 homolog (S. cerevisiae)
  • spindle pole body component 25 homolog

Background

SPC25 encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NBP2-47264
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31632
Species: Hu
Applications: ICC/IF, WB
H00060559-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-85249
Species: Hu, Mu
Applications: WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-92433
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13389
Species: Hu
Applications: IHC, IHC-P, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-82868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38751
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80774
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94187
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DANG20
Species: Hu
Applications: ELISA
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-47263PEP
Species: Hu
Applications: AC

Publications for SPC25 Protein (NBP2-47263PEP) (0)

There are no publications for SPC25 Protein (NBP2-47263PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPC25 Protein (NBP2-47263PEP) (0)

There are no reviews for SPC25 Protein (NBP2-47263PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SPC25 Protein (NBP2-47263PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPC25 Products

Blogs on SPC25

There are no specific blogs for SPC25, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SPC25 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPC25