SPC25 Antibody

Images

 
Western Blot: SPC25 Antibody [NBP2-88351] - Host: Rabbit. Target Name: SPC25. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPC25 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human SPC25. Peptide sequence: SPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SPC25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPC25 Antibody

  • AD024
  • hSpc25
  • kinetochore protein Spc25
  • MGC22228,2600017H08Rik
  • SPBC25
  • SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • spindle pole body component 25 homolog (S. cerevisiae)
  • spindle pole body component 25 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-338
Species: Hu, Mu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-92433
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-82868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38751
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80774
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94187
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-80524
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-88351
Species: Hu
Applications: WB

Publications for SPC25 Antibody (NBP2-88351) (0)

There are no publications for SPC25 Antibody (NBP2-88351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPC25 Antibody (NBP2-88351) (0)

There are no reviews for SPC25 Antibody (NBP2-88351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPC25 Antibody (NBP2-88351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPC25 Products

Bioinformatics Tool for SPC25 Antibody (NBP2-88351)

Discover related pathways, diseases and genes to SPC25 Antibody (NBP2-88351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPC25 Antibody (NBP2-88351)

Discover more about diseases related to SPC25 Antibody (NBP2-88351).
 

Pathways for SPC25 Antibody (NBP2-88351)

View related products by pathway.

PTMs for SPC25 Antibody (NBP2-88351)

Learn more about PTMs related to SPC25 Antibody (NBP2-88351).

Blogs on SPC25

There are no specific blogs for SPC25, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPC25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPC25