Recombinant Human SPC24 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPC24 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 197 of Human SPC24 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPC24

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPC24 Protein

  • FLJ90806
  • hSpc24
  • kinetochore protein Spc24
  • SPBC24
  • SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • spindle pole body component 24 homolog (S. cerevisiae)
  • spindle pole body component 24 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-2364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-21057
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00147841-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPC24 Recombinant Protein (H00147841-P01) (0)

There are no publications for SPC24 Recombinant Protein (H00147841-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPC24 Recombinant Protein (H00147841-P01) (0)

There are no reviews for SPC24 Recombinant Protein (H00147841-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPC24 Recombinant Protein (H00147841-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPC24 Products

Bioinformatics Tool for SPC24 Recombinant Protein (H00147841-P01)

Discover related pathways, diseases and genes to SPC24 Recombinant Protein (H00147841-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPC24 Recombinant Protein (H00147841-P01)

Discover more about diseases related to SPC24 Recombinant Protein (H00147841-P01).
 

Pathways for SPC24 Recombinant Protein (H00147841-P01)

View related products by pathway.

PTMs for SPC24 Recombinant Protein (H00147841-P01)

Learn more about PTMs related to SPC24 Recombinant Protein (H00147841-P01).

Blogs on SPC24

There are no specific blogs for SPC24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPC24 Antibody
NBP2-47264

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPC24 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPC24