SPATA2 Antibody (1F1)

Images

 
Western Blot: SPATA2 Antibody (1F1) [H00009825-M01] - SPATA2 monoclonal antibody (M01), clone 1F1 Analysis of SPATA2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: SPATA2 Antibody (1F1) [H00009825-M01] - Analysis of monoclonal antibody to SPATA2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SPATA2 Antibody (1F1) [H00009825-M01] - Detection limit for recombinant GST tagged SPATA2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPATA2 Antibody (1F1) Summary

Immunogen
SPATA2 (NP_006029, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVY
Localization
Nuclear
Specificity
SPATA2 - spermatogenesis associated 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPATA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publication using H00009825-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPATA2 Antibody (1F1)

  • KIAA0757FLJ13167
  • PD1spermatogenesis associated PD1
  • spermatogenesis associated 2
  • spermatogenesis-associated protein 2
  • Spermatogenesis-associated protein PD1
  • tamo

Background

SPATA2 (spermatogenesis associated 2) is thought to have a role in the regulation of spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1086
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
7268-CT
Species: Hu
Applications: BA
NBP1-76769
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, ELISA, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NB600-273
Species: Hu, Mu
Applications: IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP1-76770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NBP2-89090
Species: Hu
Applications: IHC, IHC-P
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for SPATA2 Antibody (H00009825-M01)(1)


Reviews for SPATA2 Antibody (H00009825-M01) (0)

There are no reviews for SPATA2 Antibody (H00009825-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPATA2 Antibody (H00009825-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPATA2 Products

Bioinformatics Tool for SPATA2 Antibody (H00009825-M01)

Discover related pathways, diseases and genes to SPATA2 Antibody (H00009825-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA2 Antibody (H00009825-M01)

Discover more about diseases related to SPATA2 Antibody (H00009825-M01).
 

Pathways for SPATA2 Antibody (H00009825-M01)

View related products by pathway.

Blogs on SPATA2

There are no specific blogs for SPATA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA2 Antibody (1F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA2
Entrez
OMIM
Uniprot