We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SPAG8 Recombinant Protein Antigen

Images

 
There are currently no images for SPAG8 Protein (NBP2-39092PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SPAG8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPAG8.

Source: E. coli

Amino Acid Sequence: PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPAG8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39092.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SPAG8 Recombinant Protein Antigen

  • BS-84
  • HSD-1MGC26201
  • hSMP-1
  • SMP1
  • SMP-1
  • SPAG3
  • sperm associated antigen 8
  • Sperm membrane protein 1
  • Sperm membrane protein BS-84
  • sperm-associated antigen 8

Background

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-09042
Species: Hu
Applications: Flow, ICC/IF
NB100-65887
Species: Hu
Applications: Flow, IP
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-32660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4064
Species: Mu
Applications: ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB7450
Species: Hu
Applications: IHC
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
AF821
Species: Hu, Mu
Applications: WB
NBP3-15702
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
MAB8630
Species: Hu
Applications: IHC, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-46388
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
AF4065
Species: Mu
Applications: IHC, WB
AF7178
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-92011
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-52559
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB

Publications for SPAG8 Protein (NBP2-39092PEP) (0)

There are no publications for SPAG8 Protein (NBP2-39092PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG8 Protein (NBP2-39092PEP) (0)

There are no reviews for SPAG8 Protein (NBP2-39092PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SPAG8 Protein (NBP2-39092PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPAG8 Products

Blogs on SPAG8

There are no specific blogs for SPAG8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SPAG8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG8