SPACA9 Antibody - Azide and BSA Free

Western Blot: SPACA9 Antibody [NBP2-94689] - Analysis of extracts of various cell lines, using SPACA9 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 15s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SPACA9 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SPACA9 Antibody - Azide and BSA Free (NBP2-94689) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2). AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTCL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SPACA9 Antibody - Azide and BSA Free

• C20orf117
• chromosome 20 open reading frame 117
• dJ132F21.1
• FLJ44670
• hypothetical protein LOC140710
• KIAA0889
• SOGA
• suppressor of glucose, autophagy associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MTCL2