![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0013.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Liver shows no positivity in hepatocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SPACA1 Antibody - BSA Free (NBP2-38506) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPACA1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-NBP2-38506-img0001.jpg "Immunohistochemistry: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0002.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0003.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining in human testis and endometrium tissues using anti-SPACA1 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0004.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining in human testis and endometrium tissues using anti-SPACA1 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0005.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0006.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human kidney.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0007.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human liver.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0008.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human liver.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Analysis in human testis and liver tissues using NBP2-38506 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0009.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Analysis in human testis and liver tissues using NBP2-38506 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0010.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0011.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP2-38506 (A) shows similar protein distribution across tissues to independent antibody NBP1-80792 (B).")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0012.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SPACA1-Antibody-Immunohistochemistry-Paraffin-NBP2-38506-img0014.jpg "Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP2-38506] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![N/A CXCL1/GRO alpha/KC/CINC-1 [Biotin]](https://images.novusbio.com/images2/DATA_CXCL1_DY453_ELISA_2039.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")