SP2 Antibody

Images

 
Western Blot: SP2 Antibody [NBP2-88339] - WB Suggested Anti-SP2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Transfected 293T

Product Details

Summary
Reactivity Hu, Mu, Po, Bv, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SP2. Peptide sequence: SDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVE The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Porcine (100%), Rabbit (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP2 Antibody

  • KIAA0048
  • Sp2 transcription factor
  • transcription factor Sp2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-93944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-97665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-62125
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SP2 Antibody (NBP2-88339) (0)

There are no publications for SP2 Antibody (NBP2-88339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP2 Antibody (NBP2-88339) (0)

There are no reviews for SP2 Antibody (NBP2-88339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP2 Antibody (NBP2-88339) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SP2 Products

Bioinformatics Tool for SP2 Antibody (NBP2-88339)

Discover related pathways, diseases and genes to SP2 Antibody (NBP2-88339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP2 Antibody (NBP2-88339)

Discover more about diseases related to SP2 Antibody (NBP2-88339).
 

Pathways for SP2 Antibody (NBP2-88339)

View related products by pathway.

PTMs for SP2 Antibody (NBP2-88339)

Learn more about PTMs related to SP2 Antibody (NBP2-88339).

Blogs on SP2

There are no specific blogs for SP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP2