SP2 Antibody

Images

 
Western Blot: SP2 Antibody [H00006668-B01P] - Analysis of SP2 expression in transfected 293T cell line by SP2 polyclonal antibody. Lane 1: SP2 transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SP2 Antibody Summary

Immunogen
SP2 (AAH05914.1, 1 a.a. - 249 a.a.) full-length human protein. MAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGGGNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMFLFLAFINVL
Specificity
SP2 - Sp2 transcription factor,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP2 Antibody

  • KIAA0048
  • Sp2 transcription factor
  • transcription factor Sp2

Background

This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00006668-B01P
Species: Hu
Applications: WB

Publications for SP2 Antibody (H00006668-B01P) (0)

There are no publications for SP2 Antibody (H00006668-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP2 Antibody (H00006668-B01P) (0)

There are no reviews for SP2 Antibody (H00006668-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP2 Antibody (H00006668-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP2 Products

Bioinformatics Tool for SP2 Antibody (H00006668-B01P)

Discover related pathways, diseases and genes to SP2 Antibody (H00006668-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP2 Antibody (H00006668-B01P)

Discover more about diseases related to SP2 Antibody (H00006668-B01P).
 

Pathways for SP2 Antibody (H00006668-B01P)

View related products by pathway.

PTMs for SP2 Antibody (H00006668-B01P)

Learn more about PTMs related to SP2 Antibody (H00006668-B01P).

Blogs on SP2

There are no specific blogs for SP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP2
Entrez
Uniprot