SP17 Antibody - Azide and BSA Free

Western Blot: SP17 Antibody [H00053340-B01P] - Analysis of SPA17 expression in transfected 293T cell line by SPA17 polyclonal antibody. Lane 1: SPA17 transfected lysate(16.61 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SP17 Antibody [H00053340-B01P] - Analysis of purified antibody to SPA17 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)

Immunohistochemistry-Paraffin: SP17 Antibody [H00053340-B01P] - Analysis of purified antibody to SPA17 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SP17 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SP17 Antibody - Azide and BSA Free (H00053340-B01P) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SP17 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SPA17 (NP_059121.1, 1 a.a. - 151 a.a.) full-length human protein. MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
• Specificity: Reacts with sperm autoantigenic protein 17.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SPA17
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: This antibody is reactive against transfected lysate in western blot, immunofluorescence, immunohistochemistry (paraffin sections), and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP17 Antibody - Azide and BSA Free

• Cancer/testis antigen 22
• CT22SP17-1
• Sp17-1
• SP17sperm surface protein Sp17
• sperm autoantigenic protein 17Sperm protein 17

Background

This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SP17 Antibody (H00053340-B01P)(2)

Publications using H00053340-B01P

• Zhou YT, Qiu JJ, Wang Y et al. Sperm Protein Antigen 17 Expression Correlates With Lymph Node Metastasis and Worse Overall Survival in Patients With Breast Cancer Front Oncol 2019-07-31 [PMID: 31417875] (WB, Human)
• Gjerstorff MF, Ditzel HJ. Limited SP17 expression within tumors diminishes its therapeutic potential Tissue Antigens 2012-12-01 [PMID: 23137323] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SPA17
• Entrez:
  • 53340(Human)
• Uniprot:
  • NP_059121.1(Human)