![Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human kidney, liver, lymph node and small intestine using Anti-SP100 antibody NBP1-89457 (A) shows similar protein distribution across tissues to independent antibody NBP1-86060 (B).](http://images.novusbio.com/fullsize/SP100-Antibody-Immunohistochemistry-Paraffin-NBP1-89457-img0013.jpg "Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human kidney, liver, lymph node and small intestine using Anti-SP100 antibody NBP1-89457 (A) shows similar protein distribution across tissues to independent antibody NBP1-86060 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP100 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP100 |
![Immunocytochemistry/Immunofluorescence: SP100 Antibody [NBP1-89457] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SP100-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89457-img0004.jpg "Immunocytochemistry/Immunofluorescence: SP100 Antibody [NBP1-89457] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/SP100-Antibody-Immunohistochemistry-Paraffin-NBP1-89457-img0016.jpg "Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/SP100-Antibody-Immunohistochemistry-Paraffin-NBP1-89457-img0014.jpg "Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SP100-Antibody-Immunohistochemistry-Paraffin-NBP1-89457-img0015.jpg "Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human small intestine shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SP100-Antibody-Immunohistochemistry-Paraffin-NBP1-89457-img0017.jpg "Immunohistochemistry-Paraffin: SP100 Antibody [NBP1-89457] - Staining of human liver shows no positivity in hepatocytes as expected.")
![DAN/NBL1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "DAN/NBL1 Antibody [Unconjugated]")
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")