Recombinant Human SP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 89-198 of Human SP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SP1 Protein

  • Sp1 transcription factor
  • specificity protein 1
  • transcription factor Sp1
  • TSFP1

Background

SP1 - Sp1 transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB4077
Species: Hu
Applications: WB, IHC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00006667-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SP1 Partial Recombinant Protein (H00006667-Q01) (0)

There are no publications for SP1 Partial Recombinant Protein (H00006667-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP1 Partial Recombinant Protein (H00006667-Q01) (0)

There are no reviews for SP1 Partial Recombinant Protein (H00006667-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP1 Partial Recombinant Protein (H00006667-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP1 Products

Bioinformatics Tool for SP1 Partial Recombinant Protein (H00006667-Q01)

Discover related pathways, diseases and genes to SP1 Partial Recombinant Protein (H00006667-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP1 Partial Recombinant Protein (H00006667-Q01)

Discover more about diseases related to SP1 Partial Recombinant Protein (H00006667-Q01).
 

Pathways for SP1 Partial Recombinant Protein (H00006667-Q01)

View related products by pathway.

PTMs for SP1 Partial Recombinant Protein (H00006667-Q01)

Learn more about PTMs related to SP1 Partial Recombinant Protein (H00006667-Q01).
 

Research Areas for SP1 Partial Recombinant Protein (H00006667-Q01)

Find related products by research area.

Blogs on SP1.

Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Customers Who Bought This Also Bought

SP1 Antibody
NB600-233

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SP1