SP-B/Surfactant Protein B Antibody

Images

 
Western Blot: Surfactant Protein B Antibody [H00006439-B01P] - Analysis of SFTPB expression in transfected 293T cell line by SFTPB polyclonal antibody. Lane 1: SFTPB transfected lysate(41.91 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SP-B/Surfactant Protein B Antibody Summary

Immunogen
SFTPB (NP_000533.2, 1 a.a. - 381 a.a.) full-length human protein. MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SFTPB
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP-B/Surfactant Protein B Antibody

  • 18 kDa pulmonary-surfactant protein
  • 6 kDa protein
  • PSP-B
  • pulmonary surfactant-associated protein B
  • Pulmonary surfactant-associated proteolipid SPL(Phe)
  • SFTB3
  • SFTP3
  • SFTPB
  • SMDP1
  • SP-B surfactant, pulmonary-associated protein B
  • SP-B
  • surfactant protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
MAB4077
Species: Hu
Applications: WB, IHC
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu

Publications for SP-B/Surfactant Protein B Antibody (H00006439-B01P) (0)

There are no publications for SP-B/Surfactant Protein B Antibody (H00006439-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP-B/Surfactant Protein B Antibody (H00006439-B01P) (0)

There are no reviews for SP-B/Surfactant Protein B Antibody (H00006439-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP-B/Surfactant Protein B Antibody (H00006439-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP-B/Surfactant Protein B Products

Bioinformatics Tool for SP-B/Surfactant Protein B Antibody (H00006439-B01P)

Discover related pathways, diseases and genes to SP-B/Surfactant Protein B Antibody (H00006439-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP-B/Surfactant Protein B Antibody (H00006439-B01P)

Discover more about diseases related to SP-B/Surfactant Protein B Antibody (H00006439-B01P).
 

Pathways for SP-B/Surfactant Protein B Antibody (H00006439-B01P)

View related products by pathway.

PTMs for SP-B/Surfactant Protein B Antibody (H00006439-B01P)

Learn more about PTMs related to SP-B/Surfactant Protein B Antibody (H00006439-B01P).

Blogs on SP-B/Surfactant Protein B

There are no specific blogs for SP-B/Surfactant Protein B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP-B/Surfactant Protein B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPB
Entrez
Uniprot