SOX5 Antibody (4H8) - Azide and BSA Free

Western Blot: SOX5 Antibody (4H8) [H00006660-M01-100ug] - Detection against Immunogen (31.24 KDa

ELISA: SOX5 Antibody (4H8) [H00006660-M01-100ug] - Detection limit for recombinant GST tagged SOX5 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SOX5 Antibody (4H8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SOX5 Antibody (4H8) - Azide and BSA Free (H00006660-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SOX5 (NP_008871.3, 181 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SOX5
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX5 Antibody (4H8) - Azide and BSA Free

• L-SOX5
• MGC35153
• SOX5
• SRY (sex determining region Y)-box 5
• transcription factor SOX-5

Background

SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX5
• Entrez:
  • 6660(Human)
• OMIM:
  • 604975(Human)
• Uniprot:
  • NP_008871.3(Human)