We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SOX11 Recombinant Protein Antigen

Images

 
There are currently no images for SOX11 Protein (NBP1-85823PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SOX11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX11.

Source: E. coli

Amino Acid Sequence: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOX11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85823.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOX11 Recombinant Protein Antigen

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Background

SOX11 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-14180
Species: Hu
Applications: Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
AF2569
Species: Hu
Applications: ICC, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
AF4070
Species: Hu
Applications: ICC, WB
H00006666-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-94220
Species: Hu
Applications: ELISA, WB
AF5286
Species: Hu
Applications: WB
NBP1-49872
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF3538
Species: Hu
Applications: ICC, IHC, WB
NBP1-85816
Species: Hu, Mu
Applications: ICC/IF,  IHC-P
NBP3-12898
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3369
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-85823PEP
Species: Hu
Applications: AC

Publications for SOX11 Protein (NBP1-85823PEP) (0)

There are no publications for SOX11 Protein (NBP1-85823PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX11 Protein (NBP1-85823PEP) (0)

There are no reviews for SOX11 Protein (NBP1-85823PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOX11 Protein (NBP1-85823PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX11 Products

Blogs on SOX11.

SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOX11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX11