SorCS2 Antibody (1D7)

Images

 
Western Blot: SorCS2 Antibody (1D7) [H00057537-M03] - Analysis of SORCS2 expression in HepG2 (Cat # L019V1).
Sandwich ELISA: SorCS2 Antibody (1D7) [H00057537-M03] - Detection limit for recombinant GST tagged SORCS2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SorCS2 Antibody (1D7) Summary

Immunogen
SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SORCS2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:2000
  • ELISA 1:100 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SorCS2 Antibody (1D7)

  • KIAA1329VPS10 domain receptor protein
  • SorCS2
  • sortilin-related VPS10 domain containing receptor 2
  • VPS10 domain-containing receptor SorCS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3067
Species: Mu
Applications: WB, IHC, Block
AF3457
Species: Hu
Applications: WB, ICC
AF5699
Species: Hu, Mu
Applications: WB, IHC
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5480
Species: Hu
Applications: IHC
NBP2-50163
Species: Hu, Mu
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP1-76786
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03061
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
H00057537-M03
Species: Hu
Applications: WB, ELISA

Publications for SorCS2 (H00057537-M03) (0)

There are no publications for SorCS2 (H00057537-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SorCS2 (H00057537-M03) (0)

There are no reviews for SorCS2 (H00057537-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SorCS2 (H00057537-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SorCS2 (H00057537-M03)

Discover related pathways, diseases and genes to SorCS2 (H00057537-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SorCS2 (H00057537-M03)

Discover more about diseases related to SorCS2 (H00057537-M03).
 

Pathways for SorCS2 (H00057537-M03)

View related products by pathway.

PTMs for SorCS2 (H00057537-M03)

Learn more about PTMs related to SorCS2 (H00057537-M03).

Blogs on SorCS2

There are no specific blogs for SorCS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SorCS2 Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SORCS2
Entrez