Somatostatin R1/SSTR1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Somatostatin R1/SSTR1. Peptide sequence: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SSTR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Somatostatin R1/SSTR1 Antibody - BSA Free
Background
Somatostatin acts to regulate numerous physiological processes by binding to and activating specific receptors in target tissues. Activation of these receptors by somatostatin--which is secreted by nerve and endocrine cells--regulates the secretion of insulin, glucagon and growth hormone, neuronal excitability in both the brain and the peripheral nervous system, and cell growth. Somatostatin receptors have been implicated in numerous diseases ranging from Alzheimer's to cancers of the gastrointestinal tract, breast, prostate, and pituitary.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Po
Applications: Flow, ICC, IHC, IHC-P, WB
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu
Applications: ICC, IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: WB, IHC
Publications for Somatostatin R1/SSTR1 Antibody (NBP2-88331) (0)
There are no publications for Somatostatin R1/SSTR1 Antibody (NBP2-88331).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Somatostatin R1/SSTR1 Antibody (NBP2-88331) (0)
There are no reviews for Somatostatin R1/SSTR1 Antibody (NBP2-88331).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Somatostatin R1/SSTR1 Antibody (NBP2-88331) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Somatostatin R1/SSTR1 Products
Research Areas for Somatostatin R1/SSTR1 Antibody (NBP2-88331)
Find related products by research area.
|
Blogs on Somatostatin R1/SSTR1