Somatostatin R1/SSTR1 Antibody - BSA Free

Western Blot: Somatostatin R1/SSTR1 Antibody [NBP2-88331] - WB Suggested Anti-SSTR1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: THP-1 cell lysate

Immunohistochemistry: Somatostatin R1/SSTR1 Antibody [NBP2-88331] - Immunohistochemistry with Pancreas tissue at an antibody concentration of 5ug/ml using anti-SSTR1 antibody

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Somatostatin R1/SSTR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Somatostatin R1/SSTR1 Antibody - BSA Free (NBP2-88331) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Somatostatin R1/SSTR1. Peptide sequence: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSTR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Somatostatin R1/SSTR1 Antibody - BSA Free

• G-protein coupled receptor
• Somatostatin R1
• somatostatin receptor 1
• somatostatin receptor type 1
• SomatostatinR1
• SRIF-2
• SS1R
• SS-1-R
• SS1-R
• SSR1
• SSTR1

Background

Somatostatin acts to regulate numerous physiological processes by binding to and activating specific receptors in target tissues. Activation of these receptors by somatostatin--which is secreted by nerve and endocrine cells--regulates the secretion of insulin, glucagon and growth hormone, neuronal excitability in both the brain and the peripheral nervous system, and cell growth. Somatostatin receptors have been implicated in numerous diseases ranging from Alzheimer's to cancers of the gastrointestinal tract, breast, prostate, and pituitary.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSTR1