Sodium Potassium ATPase Beta 1 Antibody (4M5T3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 204-303 of human Sodium Potassium ATPase Beta 1 (P05026). YNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
ATP1B1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Sodium Potassium ATPase Beta 1 Antibody (4M5T3)
Background
Sodium Potassium ATPase Beta 1 (ATP1B1) is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. Na/K ATPase pumps consist of alpha/beta heterodimers. Beta 1 is the glycosylated, non-catalytic component of the active enzyme responsible for the formation of these alpha/beta heterodimers. Through this assembly, the beta polypeptide regulates the number of sodium pumps transported to the plasma membrane.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560) (0)
There are no publications for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560) (0)
There are no reviews for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sodium Potassium ATPase Beta 1 Products
Research Areas for Sodium Potassium ATPase Beta 1 Antibody (NBP3-16560)
Find related products by research area.
|
Blogs on Sodium Potassium ATPase Beta 1