Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2). MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATP1A4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:200-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free
Background
The protein encoded by the Sodium Potassium ATPase Alpha 4 gene belongs to the family of P-type cation transport ATPases, and to the subfamily ofNa+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining theelectrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential forosmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electricalexcitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and asmaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This geneencodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have beenidentified. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ha, Hu, Mu, Rt, Xp
Applications: ICC/IF, IHC, IP, WB
Species: Mu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Sodium Potassium ATPase Alpha 4 Antibody (NBP2-94614) (0)
There are no publications for Sodium Potassium ATPase Alpha 4 Antibody (NBP2-94614).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sodium Potassium ATPase Alpha 4 Antibody (NBP2-94614) (0)
There are no reviews for Sodium Potassium ATPase Alpha 4 Antibody (NBP2-94614).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sodium Potassium ATPase Alpha 4 Antibody (NBP2-94614) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sodium Potassium ATPase Alpha 4 Products
Blogs on Sodium Potassium ATPase Alpha 4