Orthogonal Strategies: Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Analysis in human cerebral cortex and endometrium tissues. Corresponding ATP1A3 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human prostate shows no positivity in glandular cells as expected.
Novus Biologicals Rabbit Sodium Potassium ATPase Alpha 3 Antibody - BSA Free (NBP2-37955) is a polyclonal antibody validated for use in IHC. Anti-Sodium Potassium ATPase Alpha 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP1A3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The sodium/potassium ATPase is an integral membrane enzyme found in all cells of higher organisms and is responsible for the ATP-dependent transport of sodium and potassium across the cell membrane. This membrane-bound enzyme is related to a number of other ATPases including sarcoplasmic and endoplasmic reticulum calcium ATPase (SERCA) and plasma membrane calcium ATPase (PMCA). The sodium/potassium ATPase consists of a large, multipass, transmembrane catalytic subunit, termed the alpha subunit, and an associated smaller glycoprotein, termed the beta subunit. Studies indicate that there are three isoforms of the alpha subunit (alpha 1, alpha 2, alpha 3) and two isoforms of the beta subunit (beta 1 and beta 2) encoded by two multigene families. The different isoforms of the sodium/potassium ATPase exhibit tissue-specific and developmental patterns of expression. The alpha 1 and beta mRNAs are present in all cell types examined, whereas the alpha 2 and alpha 3 mRNAs exhibit a more restricted pattern of cell-specific expression. The alpha-3 subunit has been found in neuronal and to skeletal and cardiac muscle, lung and stomach tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Sodium Potassium ATPase Alpha 3 Antibody (NBP2-37955) (0)
There are no reviews for Sodium Potassium ATPase Alpha 3 Antibody (NBP2-37955).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Sodium Potassium ATPase Alpha 3 Antibody - BSA Free and receive a gift card or discount.