Sodium Potassium ATPase Alpha 2 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATP1A2 (NP_000693.1). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATP1A2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL.
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
112 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Sodium Potassium ATPase Alpha 2 Antibody - Azide and BSA Free
Background
The ubiquitously expressed sodium/potassium-ATPase exists as a oligomeric plasma membrane complex that couples the hydrolysis of one molecule of ATP to the importation of three Na+ ions and two K+ ions against their respective electrochemical gradients. As a member of the P-type family of ion motifs, sodium/potassium-ATPase plays a critical role in maintaining cellular volume, resting membrane potential and Na+-coupled solute transport. Multiple isoforms of three subunits, alpha, beta and gamma, comprise to form the sodium/potassium-ATPase oligomer. The 113 kDa alpha subunit contains the binding sites for ATP and the cations. With a molecular weight between 40 and 60 kDa, the glycosylated beta subunit ensures correct folding and membrane insertion of the alpha subunits. The small 6 kDa gamma subunit co-localizes with the alpha subunit in nephron segments, where it increases the affinity of sodium/potassium-ATPase for ATP. The beta subunit, but not the gamma subunit, is essential for normal activity of sodium/potassium-ATPase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, WB
Species: Mu, Rt
Applications: WB
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669) (0)
There are no publications for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669) (0)
There are no reviews for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sodium Potassium ATPase Alpha 2 Products
Research Areas for Sodium Potassium ATPase Alpha 2 Antibody (NBP2-94669)
Find related products by research area.
|
Blogs on Sodium Potassium ATPase Alpha 2