Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Images

 
Sodium Potassium ATPase was detected in immersion fixed paraffin-embedded sections of human kidney using Rabbit Anti-Human Sodium Potassium ATPase, Monoclonal Antibody (Catalog #NBP3-15427) at a 1:8000 dilution at 37° ...read more
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of NIH-3T3 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at ...read more
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution ...read more
Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of extracts from HeLa cells, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution.Membrane protein extract isolated from Hela cells. ...read more
Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of various lysates, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution. Membrane protein extract isolated from Hela cells. Secondary ...read more
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human colon using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x ...read more
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human kidney using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x ...read more
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human thyroid cancer using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 ...read more
Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Confocal imaging of human colon using Sodium Potassium ATPase Alpha 1 Rabbit mAb . DAPI was ...read more
Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Sodium Potassium ATPase Alpha 1 ...read more
Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Sodium Potassium ATPase Alpha 1 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, mIF
Clone
3L6F0
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) Summary

Description
Novus Biologicals Rabbit Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) (NBP3-15427) is a recombinant monoclonal antibody validated for use in Multiplex Immunofluorescence, IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (P05023). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ATP1A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry 1:3000 - 1:12000
  • Immunohistochemistry-Paraffin 1:3000 - 1:12000
  • Multiplex Immunofluorescence 1:8000
  • Western Blot 1:50000 - 1:200000
Theoretical MW
113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

  • ATP1A1
  • ATPase, Na+/K+ transporting, alpha 1 polypeptide
  • EC 3.6.3
  • EC 3.6.3.9
  • EC 7.2.2.13
  • K-ATPase alpha-1 subunit
  • K-ATPase catalytic subunit alpha-A protein
  • MGC3285
  • MGC51750
  • Na
  • Na(+)/K(+) ATPase alpha-1 subunit
  • Na, K-ATPase, alpha-A catalytic polypeptide
  • Na+, K+ ATPase alpha subunit
  • Na+/K+ ATPase 1
  • Sodium Potassium ATPase Alpha 1
  • sodium pump 1
  • Sodium pump subunit alpha-1
  • sodium/potassium-transporting ATPase subunit alpha-1
  • sodium-potassium-ATPase, alpha 1 polypeptide

Background

Sodium Potassium ATPase is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. The Sodium Potassium ATPase enzyme is comprised of an alpha and beta subunit. The alpha-polypeptide (Sodium Potassium ATPase Alpha 1) has been shown to be the catalytically active subunit, whereas the Beta-polypeptide appears to be necessary for the assembly and transport of the sodium pump to the plasma membrane. Sodium Potassium ATPase alpha-1 subunit, in the brain, is expressed in both neuronal and non-neuronal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-47156
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NB300-147
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-540
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, Single-Cell Western, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89282
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
NBP1-76847
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
H00000483-B01P
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-97927
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74357
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-15427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, mIF

Publications for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427) (0)

There are no publications for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427) (0)

There are no reviews for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427). (Showing 1 - 1 of 1 FAQ).

  1. I am looking forward to pick up a plasma membrane marker. I have gastric cancer cell line and I am preparing PM out of that. To just check the quality of prep, I need a plasma membrane marker.
    • Our sodium potassium ATPase and plasma membrane products may be of use to you. Please contact us at technical@novusbio.com with any additional questions.

Secondary Antibodies

 

Isotype Controls

Additional Sodium Potassium ATPase Alpha 1 Products

Research Areas for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427)

Find related products by research area.

Blogs on Sodium Potassium ATPase Alpha 1

There are no specific blogs for Sodium Potassium ATPase Alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1A1