SOCS-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SOCS-1 Antibody [NBP2-56298] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOCS-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOCS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SOCS-1 Recombinant Protein Antigen (NBP2-56298PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SOCS-1 Antibody - BSA Free

• CIS1
• Cish1
• JAB
• JABTec-interacting protein 3
• JAK binding protein
• JAK-binding protein
• SOCS1
• SOCS-1
• SOCS-1CIS1
• SSI-1
• SSI-1CISH1
• SSI1cytokine-inducible SH2 protein 1
• STAT induced SH3 protein 1
• STAT-induced STAT inhibitor 1
• suppressor of cytokine signaling 1
• TIP3
• TIP-3
• TIP3Cish1

Background

The SOCS (Suppressor of cytokine signaling) family of proteins has at least 8 members; SOCS1 to SOCS7 and CIS (cytokine inducible SH2 containing protein). SOCS1 has a role in the negative regulation of cytokines that signal through the JAK/STAT3 pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOCS1