SOAT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ACAT Antibody [NBP2-32052] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining in human adrenal gland and cerebral cortex tissues using anti-SOAT1 antibody. Corresponding SOAT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver.

Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver cancer.

Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SOAT1 Antibody - BSA Free (NBP2-32052) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SOAT1 Recombinant Protein Antigen (NBP2-32052PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SOAT1 Antibody - BSA Free

• ACACT
• ACACT1
• ACAT-1
• ACATACAT1
• acyl-Coenzyme A: cholesterol acyltransferase
• Acyl-coenzyme A:cholesterol acyltransferase 1
• Cholesterol acyltransferase 1
• EC 2.3.1.26
• RP11-215I23.2
• SOAT1
• STATSOAT
• sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
• sterol O-acyltransferase 1

Background

Acely-CoA:cholestorl acyltransferase (ACAT) is an integral membrane enzyme that belongs to type-B carboxylesterase/lipase family. ACAT catalyzes the formation of cholesteryl esters from cholesterol and long-chain fatty-acyl-coenzyme A (1). ACAT also function as a regulator of intracellular cholesterol homeostasis at single cell level. Two isoform of ACAT exists, ACAT1 and ACAT2, are expressed in liver and intestine. However, ACAT1 is only found in macrophages and SMCs (2). The accumulation of cholesteryl esters produced by ACAT in macrophages can lead to foam cell formation, an indication of early stage atherosclerosis. ACAT activity has been linked to Alzehimer's Diease, condition caused by excess amount of amyloid beta-peptide (Abeta). Atherogenic lipoproteins activate ACAT activity, where active ACAT can modulate the level of Abeta (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOAT1
• Uniprot:
  • P35610(Human)