SNX15 Antibody

Images

 
Western Blot: SNX15 Antibody [NBP1-85866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: SNX15 Antibody [NBP1-85866] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: SNX15 Antibody [NBP1-85866] - Staining of human kidney shows moderate cytoplasmic and nucleolar positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEDGEGGPTPAYLSQATELITQALRDEKAGAYAAALQGYRDGVHVLLQGVPSDPLPARQEGVKKKAAEYLKRAEEILRLHLSQLPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNX15 Protein (NBP1-85866PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX15 Antibody

  • clone iota unknown protein
  • HSAF001435
  • sorting nexin 15
  • sorting nexin-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009973-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8370
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-47203
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
AF7385
Species: Hu
Applications: WB, ICC
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
MAB5140
Species: Hu
Applications: IHC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NBP1-80813
Species: Hu
Applications: IHC, IHC-P
NBP2-03367
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
MAB8200
Species: Hu, Mu
Applications: IHC
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP

Publications for SNX15 Antibody (NBP1-85866) (0)

There are no publications for SNX15 Antibody (NBP1-85866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX15 Antibody (NBP1-85866) (0)

There are no reviews for SNX15 Antibody (NBP1-85866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNX15 Antibody (NBP1-85866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX15 Products

Bioinformatics Tool for SNX15 Antibody (NBP1-85866)

Discover related pathways, diseases and genes to SNX15 Antibody (NBP1-85866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX15 Antibody (NBP1-85866)

Discover more about diseases related to SNX15 Antibody (NBP1-85866).
 

Pathways for SNX15 Antibody (NBP1-85866)

View related products by pathway.

PTMs for SNX15 Antibody (NBP1-85866)

Learn more about PTMs related to SNX15 Antibody (NBP1-85866).

Blogs on SNX15

There are no specific blogs for SNX15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX15