![Western Blot: SNX12 Antibody [H00029934-D01P] - Analysis of SNX12 expression in mouse kidney.](http://images.novusbio.com/fullsize/SNX12-Antibody-Western-Blot-H00029934-D01P-img0003.jpg "Western Blot: SNX12 Antibody [H00029934-D01P] - Analysis of SNX12 expression in mouse kidney.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit SNX12 Antibody - Azide and BSA Free (H00029934-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | SNX12 (N/A, 1 a.a. - 172 a.a.) full-length human protein. MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA |
| Specificity | SNX12 - sorting nexin 12, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SNX12 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SNX12 Antibody (H00029934-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SNX12 Antibody [H00029934-D01P] - Analysis of SNX12 expression in transfected 293T cell line by SNX12 polyclonal antibody.Lane 1: SNX12 transfected lysate(18.92 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SNX12-Antibody-Western-Blot-H00029934-D01P-img0004.jpg "Western Blot: SNX12 Antibody [H00029934-D01P] - Analysis of SNX12 expression in transfected 293T cell line by SNX12 polyclonal antibody.Lane 1: SNX12 transfected lysate(18.92 KDa).Lane 2: Non-transfected lysate.")
![Western Blot Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A7_AF3926_Western_Blot_5364.jpg)
![Simple Western Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3926_human-mouse-rat-annexin-a7-affinity-purified-polyclonal-ab-simple-western-7112024125536..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")