SNX4 Antibody

Images

 
Western Blot: SNX4 Antibody [NBP1-88882] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SNX4 Antibody [NBP1-88882] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Western Blot: SNX4 Antibody [NBP1-88882] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNX4 Protein (NBP1-88882PEP)
Publications
Read Publication using NBP1-88882.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23563491)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX4 Antibody

  • ATG24B
  • sorting nexin 4
  • sorting nexin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NBP1-92052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89485
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-58645
Species: Hu
Applications: WB, ICC/IF

Publications for SNX4 Antibody (NBP1-88882)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SNX4 Antibody (NBP1-88882) (0)

There are no reviews for SNX4 Antibody (NBP1-88882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX4 Antibody (NBP1-88882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX4 Products

Bioinformatics Tool for SNX4 Antibody (NBP1-88882)

Discover related pathways, diseases and genes to SNX4 Antibody (NBP1-88882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX4 Antibody (NBP1-88882)

Discover more about diseases related to SNX4 Antibody (NBP1-88882).
 

Pathways for SNX4 Antibody (NBP1-88882)

View related products by pathway.

PTMs for SNX4 Antibody (NBP1-88882)

Learn more about PTMs related to SNX4 Antibody (NBP1-88882).

Blogs on SNX4

There are no specific blogs for SNX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX4