SNRPA1 Antibody - BSA Free

Immunohistochemistry: SNRPA1 Antibody [NBP3-35226] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using SNRPA1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody [NBP3-35226] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using SNRPA1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: SNRPA1 Antibody [NBP3-35226] - Western blot analysis of various lysates using SNRPA1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunohistochemistry: SNRPA1 Antibody [NBP3-35226] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using SNRPA1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody [NBP3-35226] - Immunohistochemistry analysis of paraffin-embedded Rat liver using SNRPA1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody [NBP3-35226] - Immunohistochemistry analysis of paraffin-embedded Rat lung using SNRPA1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNRPA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNRPA1 Antibody - BSA Free (NBP3-35226) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SNRPA1 (NP_003081.2).
  
  Sequence:
  MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SNRPA1 Antibody - BSA Free

• Lea1
• small nuclear ribonucleoprotein polypeptide A'
• U2 small nuclear ribonucleoprotein A'
• U2 small nuclear ribonucleoprotein polypeptide A'
• U2 snRNP A'

Background

This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPA1