SNRPA1 Antibody (2D7M1)

Western Blot: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Western blot analysis of extracts of various cell lines, using SNRPA1 antibody (NBP3-15292) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry of paraffin-embedded rat testis using SNRPA1 Rabbit mAb (NBP3-15292) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry of paraffin-embedded human breast cancer using SNRPA1 Rabbit mAb (NBP3-15292) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry of paraffin-embedded mouse lung using SNRPA1 Rabbit mAb (NBP3-15292) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human esophagus tissue using SNRPA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry analysis of SNRPA1 in paraffin-embedded mouse intestin tissue using SNRPA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human liver tissue using SNRPA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry analysis of SNRPA1 in paraffin-embedded rat intestine tissue using SNRPA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: SNRPA1 Antibody (2D7M1) [NBP3-15292] - Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human thyroid tissue using SNRPA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 2D7M1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SNRPA1 Antibody (2D7M1) Summary

• Description: Novus Biologicals Rabbit SNRPA1 Antibody (2D7M1) (NBP3-15292) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661). QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SNRPA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNRPA1 Antibody (2D7M1)

• Lea1
• small nuclear ribonucleoprotein polypeptide A'
• U2 small nuclear ribonucleoprotein A'
• U2 small nuclear ribonucleoprotein polypeptide A'
• U2 snRNP A'

Background

This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPA1