SMURF2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMURF2. Source: E. coli Amino Acid Sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SMURF2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57554. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SMURF2 Recombinant Protein Antigen
Background
Smad ubiquitination regulatory factor proteins (Smurf1 and Smurf2) are E3 ubiquitin ligase that belongs to the Hect family. Smurf proteins play an important role as regulators in TGF-beta pathway by ubiquitinating Smads and Smads associated proteins for proteasome degradation (1). Specifically, Smurf1 interacts with Smad1 and Smad5 for degradation, while Smurf2 ubiquitinates Smad1 and Smad2. Smads also functions to recruit Smurfs to various pathway components such as TGF-beta and SnoN. In particular, Smad7 acts as an adaptor protein between Smurfs and TGF-Beta receptors, allowing the receptors to be marked by Smurfs for degradation (2). Smurf2 interacts with all members of Smad family except for Smad4 and it is expressed various tissues and cell lines, such as placenta and ovarian cancer cell lines. Smurf2 has been implicated in the tumor formation and diseases progression (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)
There are no publications for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)
There are no reviews for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP) (0)
Additional SMURF2 Products
Research Areas for SMURF2 Recombinant Protein Antigen (NBP2-57554PEP)
Find related products by research area.
|
Blogs on SMURF2