Recombinant Human SMURF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMURF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 165-268 of Human SMURF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP

Protein/Peptide Type
Partial Recombinant Protein
Gene
SMURF1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMURF1 Protein

  • E3 ubiquitin ligase SMURF1
  • EC 6.3.2
  • EC 6.3.2.-
  • hSMURF1
  • KIAA1625
  • KIAA1625E3 ubiquitin-protein ligase SMURF1
  • SMAD specific E3 ubiquitin protein ligase 1
  • SMAD ubiquitination regulatory factor 1
  • Smad-specific E3 ubiquitin ligase 1
  • SMAD-specific E3 ubiquitin-protein ligase 1
  • SMURF1

Background

SMURF1 - SMAD specific E3 ubiquitin protein ligase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6916
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF3025
Species: Hu
Applications: WB, ICC
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
H00057154-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SMURF1 Partial Recombinant Protein (H00057154-Q01) (0)

There are no publications for SMURF1 Partial Recombinant Protein (H00057154-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMURF1 Partial Recombinant Protein (H00057154-Q01) (0)

There are no reviews for SMURF1 Partial Recombinant Protein (H00057154-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMURF1 Partial Recombinant Protein (H00057154-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMURF1 Products

Bioinformatics Tool for SMURF1 Partial Recombinant Protein (H00057154-Q01)

Discover related pathways, diseases and genes to SMURF1 Partial Recombinant Protein (H00057154-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMURF1 Partial Recombinant Protein (H00057154-Q01)

Discover more about diseases related to SMURF1 Partial Recombinant Protein (H00057154-Q01).
 

Pathways for SMURF1 Partial Recombinant Protein (H00057154-Q01)

View related products by pathway.

PTMs for SMURF1 Partial Recombinant Protein (H00057154-Q01)

Learn more about PTMs related to SMURF1 Partial Recombinant Protein (H00057154-Q01).

Blogs on SMURF1.

6 Fictional Character Protein Names
Check out our list of some of the funniest fictional character protein names including GOLM1, SMURF1, HOMER1, Hunchback, Lilliputian, Pokemon, Tinman Paralog, and Draculin. What are your favorite or funniest protein names? Share them in the comments;...  Read full blog post.

Customers Who Bought This Also Bought

SMURF1 Antibody (1D7)
H00057154-M01
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMURF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMURF1
Entrez